List of ingredients for products that contain the ingredient E965ii - World

2494 ingredients:

IngredientProducts*
E965ii 645
E965 645
Flavouring 515
E322 409
Sweetener 357
E420 330
E422 318
E950 300
E951 268
Emulsifier 265
Colour 262
Gum base 259
Soya lecithin 246
E903 235
E414 233
E955 221
E967 212
Oil 210
Vegetable oil and fat 210
Antioxidant 208
Natural flavouring 197
Glazing agent 189
Thickener 183
Humectant 176
E171 169
Salt 156
Dairy 147
E421 144
E321 141
Starch 131
E330 130
E953 129
Cocoa 126
E133 118
Sunflower lecithin 116
Stabiliser 114
Maltodextrins 111
Vegetable oil 104
Artificial flavouring 99
Water 94
Natural and artificial flavouring 87
Cereal 87
E170 84
E466 80
Sugar 73
Acid 72
Cocoa butter 70
Fruit 69
Plant 69
Bulking agent 68
E1200 67
Flour 67
Wheat 61
Vegetable fat 59
Acidity regulator 59
E296 58
E473 57
whey-protein-isolate 57*
soy-protein-isolate 56*
Milk 55
E500 54
Cream 54
Wheat flour 53
Cereal flour 53
Nut 52
Palm kernel oil and fat 52
Palm kernel oil 52
Fiber 50
Palm oil and fat 49
Milk powder 48
Cocoa powder 48
Coconut fat 45
E428 45
E320 45
Palm oil 42
fr:contient-une-source-de-phenylalanine 40*
fractionated-palm-kernel-oil 37*
E100 36
Protein 36
Whey 35
Butter 35
processed-with-alkali 34*
E415 34
Tapioca starch 33
milk-protein-isolate 33*
E471 31
Preservative 31
Minerals 31
Sunflower oil 31
E141 31
Egg 30
Glucose 30
Chocolate 30
Rice 29
Oat 29
Coconut oil 28
Sodium caseinate 28
Caseinate 28
E306 28
Soya 28
E440a 28
Almond 28
Milk proteins 27
Corn 27
Animal protein 27
Vitamins 27
nonfat-milk 27*
E407 26
E129 26
calcium-caseinate 26*
chocolate-flavored-coating 26*
E160 26
resinous-glaze 25*
Inulin 25
Gelling agent 25
fr:une-consommation-excessive-peut-avoir-des-effets-laxatifs 25*
Peanut 24
Oligofructose 23
E202 23
Tea 23
E341 23
vitamin-a-palmitate 23*
Thiamin 23
Green tea 23
E120 23
Whole milk powder 22
Folic acid 22
whey-protein-concentrate 22*
Green tea extract 22
Folate 22
Berries 22
E375 21
Malt 21
E960 21
Cocoa paste 21
E163 20
milk-fat 20*
E101 20
Rice flour 20
Skimmed milk powder 20
Vegetable fiber 20
Spice 19
chocolate-liquor 19*
Liquorice 19
E968 19
chewing-gum-base 19*
Rice starch 19
E472a 19
E500ii 18
E300 18
contains-less-than-2-percent-of 18*
E150a 18
Thiamin mononitrate 18
E961 17
Fruit juice 17
E412 17
Modified starch 17
E102 17
E962 17
Malted barley 17
E161b 17
Raising agent 16
Apple 16
Vegetable protein 16
Coconut 16
Sodium 16
an-emulsifier 16*
Glucose syrup 16
Soya oil 16
Barley malt extract 15
protein-blend 15*
trisource-protein-blend 15*
E307a 15
Vanilla flavouring 15
Vanilla 15
Corn syrup 15
Hydrolysed vegetable protein 15
Soy protein 15
Liquorice extract 15
artificial-color 14*
Corn starch 14
splenda-brand 14*
Strawberry 14
E160c 14
fr:Fruits des bois 14
E110 14
fr:extrait-naturel-de-the-vert 13*
Sodium citrate 13
nonfat-dry-milk 13*
Fructose 13
E901 12
Vitamin B12 12
E1518 12
peanut-butter 12*
Vitamin B6 12
E410 12
milk-derived-protein-blend 12*
Natural vanilla flavouring 11
Oat fibre 11
Fructooligosaccharide 11
Fat reduced cocoa powder 11
Dextrose 11
E503 11
soluble-vegetable-fiber 11*
Ingredient 11
E334 11
Pecan nut 11
E270 11
E553b 10
Zinc oxide 10
Zinc 10
Biotin 10
Butterfat 10
to-maintain-freshness 10*
Vegetable 10
E211 10
Raspberry 10
Lactose 10
Vitamin C 10
Hazelnut 9
Palm 9
Cyanocobalamin 9
Coating 9
Wheat bran 9
Oat flakes 9
Vanilla extract 9
uncooked-cornstarch 9*
E450 9
E150 9
unsweetened-chocolate 9*
Dark chocolate 9
E530 9
Pyridoxine hydrochloride 9
Invert sugar syrup 8
beetroot-juice 8*
soluble-corn-fiber 8*
Turmeric 8
Whey powder 8
yellow-5-6 8*
fd-c-colors 8*
Modified tapioca starch 8
d-calcium-pantothenate 8*
Gluten 8
Sunflower 8
Herb 8
Sugar syrup 8
cultured-whey 8*
cocoa-processed-with-alkali 8*
Vanillin 8
E153 8
Invert sugar 8
Seed 8
Fresh cream 8
pea-protein-concentrate 7*
metamyosyn-vpp-protein-blend 7*
vegetable-glycerin 7*
Vitamin K 7
Phylloquinone 7
vitamin-mineral-mix 7*
Blackberry 7
E420ii 7
E503ii 7
Palm fat 7
contains-less-than-2-of-each-of-the-following 7*
sodium-carboxymethylcellulose 7*
Iron 7
Menthol 7
Skim milk 7
reduced-iron 7*
fr:Isolat de protéine de soja 7
Sodium selenite 7
Roasted peanuts 7
contains-2-and-less-of-each-of-the-following 7*
arabic-gum 7*
Casein 7
mixed-tocopherols 7*
E160b 7
grape-juice-extract-and-stevia 7*
dark-chocolate-flavored-coating 7*
and-sodium-benzoate 7*
Selenium 7
Cane invert syrup 7
milk-protein-concentrate 7*
Iodised salt 7
blue-1-lake 7*
E464 7
almond-butter 6*
E301 6
Wheat gluten 6
E905 6
Glucose-fructose syrup 6
unbleached-wheat-flour 6*
E341ii 6
Yeast 6
Blackcurrant 6
Cinnamon 6
enriched-flour 6*
guar 6*
Vitamin D 6
Cherry 6
consist-of-chocolate-candy 6*
whole-wheat-flour 6*
tara 6*
carob-bean 6*
contains-2-and-less-of 6*
vegetable-gums 6*
Walnut 6
E450i 6
Soya bean 6
skim-milk-powder 6*
fr:acesulfam-k 6*
Stevia rebaudiana extract 6
Mint flavouring 6
Oat bran 6
E957 6
Oligofructose syrup 6
partially-hydrogenated-palm-kernel-oil 6*
E331 6
food-starch-modified 6*
de:enthalt-eine-phenylalaninquelle 6*
de:farbstoffe 6*
it:stabilizzante 5*
fr:excipientes 5*
de:Vollkornweizenmehl 5
to-preserve-freshness 5*
Sucrose 5
Mint 5
E460 5
Grape 5
Natural mint flavouring 5
DL-alpha tocopheryl acetate 5
Hydrogenated soy oil 5
vegetable-shortening 5*
Egg yolk 5
hydrolyzed-gelatin 5*
Salted butter 5
annato 5*
oatmeal 5*
prebiotic-tapioca-fiber 5*
and-bht 5*
Citrus fruit 5
Orange 5
Fructose syrup 5
Fruit juice concentrate 5
Cashew nuts 5
chromium-amino-acid-chelate 5*
Sesame 5
milk-chocolate-flavored-coating 5*
Milk chocolate 5
Root vegetable 5
fr:el-71 5*
E470a 5
Colza oil 5
Wholemeal flour 5
fr:isomalto-oligosaccharide 5*
de:emulgatoren 5*
fr:gelatine-alimentaire 4*
dutched-cocoa 4*
l-glutamine 4*
Wheat flakes 4
4*
fr:Pétales de blé 4
E307 4
yellow-5-lake 4*
Pistachio nuts 4
ingredients-consist-of-chocolate-candy 4*
Lemon juice 4
caramel-filling 4*
Whole egg 4
Cranberry 4
E452 4
peanut-flour 4*
E341iii 4
E223 4
sunflower-oil-with-tocopherols 4*
E200 4
natural-artificial-flavor 4*
E132 4
Canola oil 4
E339 4
hydrolyzed-whey-protein-isolate 4*
it:agente-di-rivestimento 4*
gum-acacia 4*
fr:une-consommation-excessive-peut-entrainer-des-effets-laxatifs 4*
Blueberry 4
modified-palm-kernel-oil 4*
Bran 4
red-3 4*
Flax seed 4
Barley malt flour 4
E304 4
Safflower 4
sucrose-fatty-acid-esters 4*
Spirulina concentrate 4
Spirulina 4
Egg white 4
Acacia fibre 4
Corn flakes 4
Condensed milk 4
an-artificial-flavor 4*
strawberries 4*
Fluoride 4
Barley flour 4
E472e 4
Elder 4
Wheat starch 4
E131 4
fr:extrudes-de-soja 4*
Brown flax seeds 4
dried-skimmed-milk 4*
E327 4
Coffee 4
phenylketonurics 4*
fr:821 4*
Apple fiber 4
es:100g 3*
es:mezcla-de-tocoferoles 3*
es:crema-vegetal 3*
es:hojuelas-de-avena 3*
Puffed rice 3
Pantothenic Acid 3
fr:dans-le-coeur 3*
fr:fourrage-fruit 3*
fr:parfum-menthe 3*
it:addensante 3*
Safflower concentrate 3
it:estratto-di-malto-d-orzo 3*
es:fibra-soluble 3*
Clarified butter 3
Skimmed milk 3
Potato starch 3
Oat flour 3
from-chicory-r 3*
Copper 3
Apple juice 3
natural-f 3*
Fat 3
soy-nuggets 3*
Buttermilk 3
Roasted nibbed hazelnuts 3
Filtered water 3
Wheat germ 3
fru 3*
from-chicory-root 3*
soy-crisps 3*
peanut-flavored-coating 3*
E481 3
for-color 3*
Whole grain rolled oats 3
Potassium fluoride 3
fr:hydrolysed-collagen 3*
propylene-glycol-monoester 3*
Sodium chloride 3
E476 3
Coffee extract 3
Modified corn starch 3
E1400 3
fr:protein-blend 3*
E297 3
Peanut oil 3
acacia 3*
Peppermint 3
contains-less-than-2-of 3*
Vitamin A 3
to-help-protect-flavor 3*
E510 3
partially-hydrogenated-soybean-oil-and-cottonseed-oils 3*
partially-defatted-peanut-flour 3*
less-than-2-of 3*
Soy flour 3
citrus-fibre 3*
resistant-maltodextrin 3*
E340ii 3
Potassium iodide 3
a-soluble-dietary-fiber 3*
for-anti-sticking 3*
Chicory 3
E966 3
E409 3
Iodine 3
crushed-wheat 3*
E650 3
es:solidos-de-leche 3*
raspberries 3*
dark-chocolate-and-coconut-flavored-coating 3*
fr:dans-le-produit 3*
Lemon Balm 3
fr:a 3*
Lemon 3
White chocolate 3
mono-and-diglycerides-with-citric-acid 3*
fr:Pommes en poudre 3
modified-waxy-corn-starch 3*
E340 3
fr:agent-de-charge-phosphates-de-calcium 3*
Carrot 3
Star anise 3
de:Verdickungsmittel Gummi arabicum 3
mono-diglycerides 3*
Chopped hazelnuts 3
Whole wheat 3
Corn flour 3
E472c 3
chocolate-flavored-chips 3*
fr:gomme 3*
Yeast powder 3
artificial-colors 3*
E325 3
Purée 3
E162 3
Flavour enhancer 3
cocoa-soy-nuggets 3*
Wheat dextrose 3
Concentrated apple juice 3
whey-solids 3*
Coconut powder 3
fr:contient 3*
fr:aspartame-acesulfame-k 3*
currants 3*
Redcurrant 3
shea 3*
Sultanas 3
fr:milk-fat 3*
Cholecalciferol 3
fr:isomaltol 3*
th:soy-protein-isolate 2*
es:esteres-de-poliglicerol-de-acidos-grasos 2*
es:solidos-de-mantequilla 2*
es:saborizante 2*
es:32mg 2*
Lactose and milk proteins 2
fr:puree-de-fruits-rouges 2*
es:cereal-extruido 2*
es:goma-base 2*
E442 2
de:kann-bei-ubermassigem-verzehr-abfuhrend-wirken 2*
Strawberry flavouring 2
fr:pour-votre-sante 2*
fr:equilibree-et-un-mode-de-vie-sain-sont-importants 2*
fr:contains-a-source-of-phenylalanine 2*
it:umidificante 2*
fr:el-33 2*
fr:framboise-en-poudre 2*
fr:concentre-de-patate-douce 2*
fr:concentre-de-jus-de-carottes-noires 2*
es:harina-de-avena 2*
it:edulcorante 2*
Thyme 2
fr:extraits-de-fruits-et-de-plantes-colorants 2*
Fresh egg 2
soluble-dietary-fiber 2*
choco-graham-ingredients 2*
orange-blossom 2*
serv-size 2*
cocoa-crisps 2*
pure-vegetable-ghee 2*
calc 2*
palm-kern 2*
fr:citroenzuur 2*
non-fat-dry-milk 2*
Sesame seeds 2
vegetable-glycerine 2*
soy-crisp 2*
fr:arome-naturel-de 2*
premier-protein-fiber-bar-protein-blend 2*
ingredients-consist-of-dark-chocolate 2*
nonfat-dry-milk-solids 2*
made-with-corn-extract 2*
Pure vanilla extract 2
malititol 2*
fr:caseinate-de-calcium 2*
4mg 2*
E1510 2
Pea protein 2
fr:en 2*
fr:flocons-de-cereales-grillees 2*
fruct 2*
pe 2*
2*
fr:e500-ii 2*
partially-hydrolyzed-milk-protein-isolate 2*
soy-protein-isola 2*
fr:peanut-flour 2*
rye-chops 2*
modified 2*
fr:kann-bei-ubermabigem-verzehr-abfuhrend-wirken 2*
E262 2
fr:rapeseed-oil 2*
dl-alpha-tocopherol-acetate 2*
Copper gluconate 2
titanium-dioxide-color 2*
fr:sucroesthers-d-acides-gras 2*
Modified milk ingredients 2
Calcium pantothenate 2
fr:kaumasse 2*
fr:kakaomasse 2*
heavy-cream 2*
less-than-1-of 2*
contains-2-and-less 2*
Rye flour 2
food-starch 2*
fr:information-nutritionnelle 2*
de:sussungsmittel-sorbit 2*
Beef gelatin 2
artificial-and 2*
E452vi 2
sucros 2*
de:farbstoff-e133 2*
fr:cocoa-mass 2*
fractiona 2*
Calcium 2
Cornmeal 2
fr:sojalecithin 2*
chicory-root-fiber 2*
fr:allergenes 2*
green-tea-e 2*
powdered-whey-protein-concentrate 2*
to-preserve 2*
cocoa-mass 2*
fr:extrudes-de-cereales 2*
phyllo-made-with-unbleached-wheat-flour 2*
enriched-wheat-flour 2*
Mango 2
Retinyl acetate 2
nut-meats 2*
fr:jus-de-fraise-en-poudre 2*
Hydrogenated fat 2
fr:s 2*
Buckwheat 2
processed-with-alkal 2*
de:emulgator-sojalecithin 2*
canola 2*
fr:isolat-de-soja 2*
food-color 2*
es:100-g 2*
fr:monoglycerides 2*
fr:edulcorantes 2*
fr:saveur-naturelle 2*
consist-of-milk-chocolate 2*
soy-c 2*
non-fat-milk 2*
fr:energie-619kj 2*
es:salvado-de-avena 2*
fr:emulsiiants 2*
soy-lecithin-emulsifier 2*
cane-sugar-syrup 2*
ammonia-caramel-color 2*
fr:mono-et-diglycerides 2*
fr:manitol 2*
c 2*
fr:billes-croustillantes-au-ble-et-au-seigle 2*
E451 2
rose-water 2*
yogurt-powder 2*
fr:a-consommer-de-preference-avant-le 2*
a-natural-antioxidant 2*
cocoa-powder-processed-with-alkali 2*
fr:aroma-s 2*
fr:melange-proteique 2*
es:contiene-tbhq 2*
es:hojuelas-de-maiz 2*
fr:Jus de sureau concentré 2
Elderberry 2
fr:warning 2*
fr:Jus de sureau 2
Animal 2
Beef 2
processed-with-alk 2*
fruit-puree 2*
Plant extracts 2
es:aceite-refinado-de-girasol 2*
calci 2*
fr:energie 2*
fr:cereales-croustillantes-riches-en-proteines 2*
Caramelised sugar 2
t 2*
de:sonnenblumenlecithin 2*
fr:antioxidante 2*
fr:sans-gluten 2*
fr:jarabe-de-maltitol 2*
fr:ingredients-edulcorants 2*
Strawberry puree 2
Buttermilk powder 2
Bamboo fibre 2
fr:glicerina 2*
E123 2
Wheat fiber 2
fr:les-informations-en-gras-sont-destinees-aux-personnes-intolerantes-et-allergiques 2*
cranberries 2*
fr:une-consommation-excessive-peut-avoir-des-effects-laxatifs 2*
toasted-mallow-ingredients 2*
E570 2
Goji 2
it:olio-vegetale-di-girasole 2*
fr:el-518 2*
fr:agent-denrobage 2*
fr:coconut-cil 2*
fr:mattitol 2*
fr:Fruits rouges lyophilisés 2
Rice syrup 2
fr:preparation-a-base-d-huile-de-noix-raffinee 2*
E392 2
fr:natural-mixed-tocopherols 2*
de:Weissmehl 2
dairy-cream 2*
in-varying-proportions 2*
rose-and-orange-blossom-water 2*
fr:Protéines de petit-lait 2
Wheat protein 2
artificial-sweeteners 2*
Cottonseed oil 2
es:esteres-de-propilenglicol-de-acidos-grasos 2*
Pineapple 2
fr:gomme-a-macher 2*
de:sussungsmittel-mannit 2*
de:farbstoff-e171 2*
E920 2
Walnut oil 2
de:antioxidationsmittel-bha 2*
fr:arabique 2*
E904 2
fr:kollagenhydrolysat 2*
fr:cacahuetes-hachees-et-grillees 2*
fr:whey-protein-concentrate 2*
dried-skimmed-yogurt 2*
sal-and-mango 2*
fr:lecitina-de-soja 2*
fr:stabilisator 2*
Whole milk 2
fr:sugar-free-caramel 2*
fr:ili 2*
es:ingredientes 2*
Fortified wheat flour 2
fr:el171 2*
fr:soya-protein-isolate 2*
Instant coffee 2
fr:sodium-de-stearate 2*
fr:Pétales de sarrasin 2
Wheat malt 2
fr:zutaten 2*
fr:maltitsirup 2*
fr:emulgator 2*
Hydrogenated vegetable fat 2
fr:ledthine-de-tournesol 2*
sucrose-fatty-acid 2*
fr:aliments-colorants 2*
es:contiene-derivad0-de-soya 1*
es:contiene-fenilalanina 1*
es:0-2-g 1*
es:0-3-g 1*
es:0-6-g 1*
es:1-g 1*
es:goma-celulosa-yalmidon 1*
es:18-g 1*
es:28-g 1*
es:edulcorantes-artificiales 1*
E902 1
es:fosfato-de-calcio-proteina-de-leche 1*
es:estearato-de-sodio 1*
es:fair-trade-organic 1*
es:elaborado-por 1*
es:mar-este-producto-contiene-gluten 1*
es:c-p-45-marca-registrada-fecha-de-caducidad-y-lote-impresos-en-el-empaque 1*
es:mexico 1*
es:jalisco 1*
es:zapopan 1*
es:ejido-no-300 1*
es:este-producto-puede-contener-trazas-de 1*
es:goma-guap-lecitina-de-soya 1*
es:harina-de-trig-aceite-vegetal 1*
th:containstree-nuts-milk 1*
th:stevia-allergy-information 1*
th:calc-q-aphne-fiber 1*
th:protein-blend 1*
th:soy-crisps 1*
th:per-serving-calories50-vitamin-d 1*
fr:bleu-brillant-fof 1*
fr:contient-une-source-de-phenylalanine-8092-5170 1*
fr:graisse-de-noix-de-coca-correcteur-d-acidite 1*
fr:lecithine-de-soja-sucroesters-d-acides-gras 1*
fr:ssorbitol 1*
es:espesante-pectina-de-fruta 1*
E316 1
th:antioxidaht 1*
th:6ns33-flavour-enhancer 1*
th:lean-pork 1*
sl:arome 1*
sl:gumi-iz-zrn-rožčeva 1*
sl:maltodekstrin 1*
sl:mlečne-beljakovine 1*
sl:sladila 1*
it:grano-tenero-tipo-2 1*
it:e-assente 1*
it:aspetto-e-sapore-del-prodotto 1*
it:impiegato-per-migliorare-struttura 1*
it:e-altra-frutta-a-guscio 1*
th:naturarcolour 1*
it:olio-di-girasole-alto-oleico 1*
it:sul-prodotto-finito 1*
it:zuccheri-aggiunti-con-edulcoranti-ingredienti 1*
es:0-43g 1*
es:6-12g 1*
es:cacahuate-y-coco-v1-conservese-en-lugar-seco-y-fresco 1*
es:acido-citrico-caramelo-clase-i 1*
th:chicory-root-fibel 1*
es:jugo-concentrado-de-limon 1*
pl:baza-gumowa 1*
fr:Protéines de blé 1
fr:acide-citrique8330 1*
fr:extrait-de-racine-pour-halawa-regulateur-d-acidite 1*
it:contiene-gli-zuccheri-naturalmente-presenti-nel-latte 1*
fr:innrediont-e 1*
fr:a-consommation-excessive-peut-avoir-des-effets-laxatifs 1*
fr:huile-de-palme-et-huile-de-graine-de-karite 1*
fr:enrobage-du-lait 1*
spearmint-flavour-xylitol-chewing-gum 1*
caramel-flavoured-layer 1*
fr:essence-d-eucalyptus 1*
nl:e1 1*
nl:allergie-informatie 1*
fr:isolat-de-proteine-de-lait 1*
Whey protein 1
th:for-color 1*
fr:concentre-de-proteine-de-lait 1*
fr:9-mg-par-portion-de-41-g 1*
E418 1
fr:mono-diglycerides 1*
fr:huile-de-palmiste-modifiee 1*
fr:and-natural-vanilla-extract 1*
fr:calcium-tate 1*
fr:graham-cracker-and-marshmallow-flavors 1*
fr:hydrolyzed-polydextrose 1*
fr:ocolate-flavored-coating 1*
it:perfetti-van-melle-italia-s-r-l 1*
it:un-consumo-eccessivo-puo-avere-perfetti-29-ge-effetti-lassativi 1*
it:contiene-una-fonte-di-fenilalanina 1*
it:l-ambiente-xilitolo 1*
it:senza-glutine 1*
it:chewing-gum-in-confetti-con-edulcoranti 1*
de:enthalt-eine-phenylalanin-quelle 1*
de:aroma-sussungsmittel 1*
de:carnaubawachs-antioxidationsmittel 1*
de:zuckerester-von-speisefetsa-re-sofalecithin-gelatine 1*
de:weinsaure-cleronensare-apfelsaure 1*
de:im-fertigen-produkt-robeeraroma-sauerungsmittel-citronensaure-sane-sauerungsmittel 1*
de:apfelpulver-991-in-der-fullung 1*
de:acesultam-kaumasse 1*
de:cellulosea-emulgatoren 1*
de:chee-zuckerzusatz-enthalt-von-natur-aus-u-kougummi-mit-erdbeergeschmack-s1bungamittein 1*
es:0-007-g 1*
es:6-12-g 1*
es:0-009-g 1*
es:100-g-de-producto 1*
es:6-93-g 1*
es:caramelo-clase-lll 1*
es:solidos-de-fresa 1*
fr:glycosydes-de-steviol 1*
fr:le-lactobacillus-casei-shirota 1*
hu:fagyasztva-szaritott-eperdarabka 1*
hu:lapitott-zabpehely 1*
es:esteres-aceticos-y-de-acidos-grasos-del-glicerol-y-lecitina-de-soya 1*
hu:osszetevők 1*
es:antihumectante 1*
es:glicerina-e422 1*
es:aromatizante-identico-al-vainilla-natural 1*
es:elaborado-con-55-q-de-fresa-por-100-g-de-producto 1*
es:chispas-simil-chocolate 1*
es:chispas-de-chocolate-sucedaneo 1*
es:avena-laminada 1*
es:arandano 1*
es:sorbitol-humectante 1*
es:30mg 1*
es:ucralosa 1*
Hydrolyzed wheat protein 1
fr:gelatine-hydrolysee 1*
fr:chocolat-de-couverture-au-lait 1*
fr:une-consommation-excessive-peut-avoir-des-effets-laxatifs-contient-une-source-de-phenylalanine 1*
fi:ja-carmolis-oljy 1*
es:3-g 1*
fi:aromit 1*
fi:makeutusaineet 1*
fi:sakeuttamisaine-arabikumi 1*
fr:avec-engred-ents 1*
fr:zu-urteregelaar 1*
fr:pectinen 1*
nl:palmpit 1*
colouring-agent 1*
b12-salt 1*
k 1*
a 1*
E319 1
vitamine 1*
acidulant 1*
Molybdenum 1
Sodium molybdate 1
Chromium 1
ii 1*
fr:energie-684-kj 1*
fr:se-sodique-contient-une-source-de-phenylalanine-une-consommation-excessive-peutavoirdes-effets-laxa-valeurs-nfitionnelles-par-100-g 1*
fr:complexes-cuivriques-dechlorophyllines 1*
fr:ageitdenrobage 1*
th:contains-fish-product 1*
fr:yakult-light-est-sans-gluten 1*
es:0-01-g 1*
fr:lactobacillus-casel-shirota 1*
fr:acide-ciuique 1*
fr:groseille-0-396 1*
fr:framboise-fraise-0-396 1*
Zante currant 1
fr:flavoringy 1*
fr:cocoa-powder-leqfin 1*
fr:bezalu-encvvnn 1*
fr:excessive-consumotion-maycause-laxative-effects-ma-contiinpanuts-nd-nuts-k-protdrg-tyiaa-s-eskgvm-l-karprtir-qtn-aremou-var-ilky-magane-v-k2y-aovej-poiqvc 1*
fr:extruded-crispies 1*
fr:cocoa-coating 1*
fr:concentrateand-soya-protein-isolate 1*
fr:ingrdtents 1*
fr:gluten-free-9fe-kzct-40-g 1*
fr:contains-sugar-and-sweeteners 1*
fr:l-camitine-and-vanilla-flavour-dipped-in-cocoa-icing 1*
es:extracto-de-malta-de 1*
es:agentes-de-goma-arabiga 1*
es:germen-de 1*
es:copos-de-arroz-y-de-trigo-integral 1*
es:extracto-rico-toccteroies 1*
es:karite 1*
es:pure-de-manzana-concentrado 1*
es:e50311 1*
es:salvado-de-barritas-trigo 1*
es:emu-gente 1*
es:aroma-natural-s-cubos-sabor-naranja 1*
es:gotas-de-chocolate-negro 1*
fr:copeaux-de-noix-de-coco 1*
es:arabe-de-maltitol 1*
es:informacien-nutricional 1*
es:contiene-una-fuente-de-fenilalanina 1*
es:sabor-a-resa 1*
es:sin-azucar-con-edulcorantes 1*
fr:une-source-de-phenylalaninel-emploi-extrerne-peut-voir-un-effet-laxatif 1*
excessive-consumption-may-induce-laxative-effects 1*
fr:contient-aspartamo 1*
fr:extrait-cire-de-carnauba 1*
fr:agent-d-enrc-ge 1*
fr:isomalc-acesulfamek-parurne 1*
fr:farine-de-blei-farine-de-ble-entier 1*
gluconate 1*
fr:indications 1*
fr:contient-des-sucres-naturellement-presents 1*
E225 1
fr:corant 1*
fr:de-pteroylmonoglutamique 1*
fr:aci 1*
hu:palma 1*
da:Vitamin A og D 1
fr:vitamine-bi 1*
fr:farine-de-malt-d10rge 1*
de:erdbeerpulver 1*
fr:beurre-anhydre 1*
fr:couverture-de-chocolat-au-lait-sans-sucres-ajoutes-avec-edulcorants 1*
E224 1
es:galleta-sin-azucares-anadidos-con-edulcorantes 1*
fr:huile-de-palme-de-karite 1*
es:cobertura-de-chocolate-negro-con-70-de-cacao-sin-azucares-anadidos-con-edulcorantes 1*
fr:distrbtje-en-france-par-solinest-sas 1*
fr:holland 1*
fr:perfetti-van-benelux-b-v 1*
fr:une-consommation-excessive-peut-avoir-des-effets-laxatif-contient-une-source-de-phenylalanine 1*
fr:agen-d-enrobage 1*
fr:fcf 1*
fr:xanthan-gun 1*
fr:creme-de-noisette 1*
fr:store-in-a-cool-and-dry-place 1*
fr:antioxidant-glazing-agent 1*
fr:sucrose-esters-tlaltodextrin 1*
th:whey-protein-concentrate 1*
de:grunteeextrakt 1*
de:cellulosegummi-gummi-arabicum 1*
pl:emulgator-lecytyna-sojowa 1*
de:mit-sussungsmitteln 1*
fr:106ge 1*
th:c-milk-solids 1*
fr:une-alimentation-variee 1*
de:glycerin-maltodextrin 1*
de:himbeere 1*
hu:etkezesi-s0 1*
de:erdbeere 1*
de:gehartet 1*
de:fruchtsafte 1*
Banana 1
nl:0 1*
es:isomaltosa 1*
fr:sucralose-gomme-base 1*
it:carminii 1*
es:0-65g 1*
fr:poudre-de-jus-de-fruit 1*
fr:4800-c-breda 1*
fr:gomme-xanthan 1*
fr:sucroesters-lecithine-de-graisse-de-noix-de-coco 1*
fr:brillant-fcf 1*
fr:agente-de-recubrimiento-carnauba 1*
fr:ole-grasa-de-coco 1*
fr:goma-arebiga 1*
b2 1*
fr:xilitol 1*
fr:xanthan-gun-gum-arabic 1*
fr:sucrose-estes-of-fattyacids 1*
fr:citro-enzuur 1*
fr:xylitolt-sorbitol 1*
fr:un-consumo-excesivo-puede-producir-aectos-laxantes 1*
fr:espesantes 1*
es:0-01g 1*
fr:emulgentes 1*
fr:almiden 1*
th:whole-milk-solic-soy-lecithin 1*
fr:sucralosa 1*
fr:manitob-jarabe-de-maltitol 1*
fr:es-chicles-con-sabor-a-menta 1*
fr:contains-source-of-phenylalahioe 1*
fr:consumption-may-produce-laxative-effects 1*
fr:colocr 1*
fr:green 1*
fr:starchrmaltodextrin 1*
pl:spożycie-w-nadmiernych-ilościach-może-wywołać-efekt-przeczyszczający 1*
hu:novenyi-zsir 1*
fr:nutrition-information-per-100-g 1*
fr:8072-5725 1*
fr:ingredients-dulcorants-kylitol 1*
fr:correcteur-dactdite-de-sodium 1*
fr:e32il-carnauba 1*
fr:aaents-epaississants 1*
fr:aspartamo 1*
fr:lecithine-de-gras 1*
fr:nijtrition-facts 1*
fr:sorbitof 1*
fr:chewing 1*
fr:ce-produit-est-sans-aspartame 1*
fr:gomme-arabic 1*
fr:extrait-de-salvadora-persica 1*
fr:contient-de-la-lecthine-de-soja 1*
fr:fraise-de 1*
Natural orange flavouring 1
fr:pamplemousse-rouge-de 1*
fr:jus-de-fruits-a-partir-de-concentres 1*
it:pasta-di-fichi-essiccati 1*
it:fibra-di-frumento 1*
it:correttore-di-acidita 1*
Apple purée 1
it:ripieno-alla-frutta 1*
fr:correcteur-dlacidit 1*
fr:ingrediene 1*
fr:parfum-menthe-verte 1*
fr:glycerol-epaississants 1*
fr:sucroesters-d-acides-gras-de-noix-de-coco 1*
fr:gomme-de-cellulose-emulsifiant 1*
fr:gomme-bases-aromes 1*
fr:edu-corants-maltitol-sorbitol 1*
fr:peut-contenir-des-traces-d-autres-cereales-contenant-du-gluten 1*
fr:excessive-consumptid-may-produce-laxative-effects 1*
fr:spearmint-flavour 1*
de:kaugummi-mit-fruchtgeschmack 1*
fr:chewing-gum-with-sweeteners 1*
fr:sorbit 1*
fr:sucroesters-diacides-gras 1*
fr:sucroesteres-de-acidos-grasos 1*
fr:enthalt-eine-phenylalaninquellesl 1*
fr:t-antioxidationsmittel 1*
fr:carnaubawachs 1*
fr:uberzugsmittel 1*
fr:starke 1*
fr:natriumhydrogencarbonat 1*
fr:siureregulator 1*
fr:verdickungsmittel 1*
fr:aromen 1*
fr:xyljt 1*
fr:Purée de pomme de terre 1
fr:mit-suflungsmitteln 1*
fr:contient-une-source-de-phenyjajanine 1*
fr:brilfiant-blue-fcf 1*
fr:correcteur-ditidite 1*
fr:tol 1*
fr:edulcorantsl-lt 1*
Yogurt 1
it:difasfato-disodico 1*
it:bicarbonato-acido-di-ammenio 1*
it:uova-fresche-da-galline-allevate-a-terra 1*
it:ingredienti-farina-di-frumento-tipo-2 1*
Shea butter 1
it:acidificante 1*
it:senza-zucchero 1*
it:purea-di-ciliegie-45-corrispondenti-all-11-del-totale-ingredienti 1*
it:un-consumo-eccessivo-puo-provocare-effetti-lassativi 1*
it:contiene-naturalmente-zuccheri 1*
es:crispin-de-maiz-y-arroz-marron 1*
it:glutine-di-frumento 1*
Natural yeast 1
it:oli-e-grassi-vegetali-non-idrogenati 1*
it:farcitura-alla-ciliegia 1*
it:latte-fresco-pastorizzato 1*
it:olio-di-palma-non-idrogenato 1*
citric-acid-flavors 1*
halawa-extract 1*
fr:erythritol-maltitol 1*
ground-sesame 1*
fr:830 1*
fr:a-partir-de-concentres 1*
fr:denrobage 1*
fr:el-61 1*
fr:acesulfamek 1*
fr:gomme-bag 1*
fr:energie-743kj 1*
fr:e1518j-e133i-une-consommation-excessive-peut-avoir-des-effetslaxatifsl-contientune-source-de-phenylalanine 1*
fr:xylieol 1*
fr:edulaijiltj 1*
es:derivado-de-leche-libre-de-lactosa 1*
fr:raisins-de-smyme 1*
fr:821-contient-une-source-de-phenylalanine 1*
es:fenilcetonuricos 1*
fr:el-63 1*
fr:citrate-de-trisodium 1*
Cream powder 1
fr:acesulfame 1*
fr:humectans 1*
coloring-agent 1*
fr:correctteur-d-acidite 1*
fr:jus-de-pomme-concentre-une-consommation-excessive-peut-avoir-des-effets-laxatifs 1*
nl:gom 1*
fr:gomma-base 1*
fr:ne 1*
fr:avec-antioxy 1*
fr:xytitol 1*
Concentrated raspberry juice 1
Raspberry juice 1
Concentrated raspberry juice from concentrate 1
de:sowie-weitere-hilfsstoffe 1*
de:mit-salbei-extrakt-1-1-mg 1*
es:solidos-de-manzana 1*
Spinach 1
de:brennessel 1*
de:extrakte-aus 1*
de:kokosol 1*
de:menthol-3-2-mg 1*
fr:15mg-glycerol 1*
fr:essences-de-menthe 1*
fr:vitamine-c-9-8-mg 1*
Manganese 1
fr:anthocyanes-e163 1*
fr:15-4-mg-jus-de-cassis-concentre 1*
fr:18-5-mg-glycerol 1*
fr:contains-a-source-of-phenylalanine-8090-8258 1*
fr:feuilles-de-mure 1*
fr:extrait-aqueux-d-herbes-medicinales 1*
fr:huile-de-fenouil-0-5-mg 1*
fr:menthol-1-1-mg 1*
fr:essence-d-eucalyptus-3-mg 1*
de:glycerin-15-mg 1*
fr:lichen-d-islande 1*
fr:de-bouillon-blanc-et-de-primevere 1*
Sage 1
fr:5-5g 1*
de:sorbit-e-aspartam 1*
chocolate-with-sweetener 1*
fr:composition-par-bonbon 1*
fr:sorbate-de-potassium-e202 1*
de:arone-verdickungsmittel-gummi-arabicum 1*
fr:10mg-vitamine-c 1*
fr:20mg-glycerol 1*
fr:koel-en-droog-bewaren-ingredi-enser 1*
it:cioccolato-con-edulcoranti 1*
nat 1*
fr:agents-de-glacage 1*
es:saborizante-natural-y-artificial-a-vainilla 1*
de:sussstoff 1*
fr:flocons-collagene-hydrolyse 1*
fr:sec-et-a-l-abri-du-soleil-in-a-cool 1*
matltodextrin 1*
apple-cider-vineg 1*
fr:voir-impression 1*
milk-chocolaty-coating 1*
hydrolyzed-gelain 1*
fr:jugos-de-concentrados 1*
Concentrated whey protein 1
annato-turmeric 1*
E160e 1
modified-palm-kernel 1*
nonfat-dried-milk 1*
inulin-dark-chocolate 1*
soy-protein-nuggets 1*
neo 1*
marshmallow-cream-layer 1*
fr:corn-malto 1*
fr:huile-essentielle-naturelle-de-menthe-et-d-eucalyptus-et-menthol 1*
less-than-2-of-malic-acid 1*
fr:huile-de-mais-fractionne 1*
maltitol-gum-base 1*
fr:billes-croustillantes-au-ble-et-au-riz-avec-du-cacao 1*
carauba-wax 1*
it:lo-zucchero 1*
fr:farine-d-arachides-partielle 1*
to-perserve-freshness 1*
colored-with-titanium-dioxide 1*
red-40-lake 1*
food-acids 1*
ohyeah-blend-consisting-of-whey-protein-isolate 1*
fr:con-edulcorantes-ingredientes 1*
de:mais-kakao-extrudat 1*
fr:enrobage-chocolat-noir 1*
es:contiene-trigo-y-otros-cereales-con-gluten 1*
Thiamin hydrochloride 1
manila-clam-sauce 1*
yucca-extract 1*
fr:acide-linoleique-conjuguee-de-l-huile-de-tournesol 1*
E959 1
milk-chocolate-drops 1*
l-lydrolyzed-collagen 1*
fr:acesulfane-k 1*
fr:dragees-sans-sucres-avec-baies-concentres 1*
fr:lecithine-de-soja2 1*
contains-0-5-and-less-of-the-following 1*
hydrolyzed-collagen 1*
wheat-malt-flour 1*
fr:lecithine-de-so 1*
fr:dont-1-1-mg-extrait-de-sauges 1*
cell 1*
monoglycerides 1*
no-sugar-added-strawberry-layer 1*
fr:gamme-base 1*
fr:i-valeurs-frgwenergy 1*
to-mainta 1*
fr:a-contem-gluten 1*
rice-s 1*
es:trigo-trigo-leche-digliceridos-recubrimiento 1*
fr:beta-carotene-and-chromium-chlo 1*
es:100g-de-producto 1*
strawberri 1*
fr:maltit-sirup 1*
sugar-free-milk-chocolate 1*
sv:vegetabilisk-olja-och-fett 1*
fractionated-palm-kernel-and-palm-oil 1*
fr:2902 1*
sunflower-oi 1*
nonfat-d 1*
6939-101 1*
to-pr 1*
to-protect-flavo 1*
es:jugo-de-manzana-cocoa-canela-dextrusa 1*
de:pflanzliches-ol 1*
unbleached-unbromated-wheat-flour 1*
cocoabutter 1*
sweet-tea-ingredients 1*
soyprotein-isolate 1*
cultured-nonfat-milk 1*
es:4-g 1*
Liquorice root extract 1
sucrolose 1*
fr:sucralosel-non-hydrogenated-palm-and-palm-kernel-oil 1*
fr:proteine-de-lait-l 1*
fr:edulcorante 1*
fr:aux-gouts-menthol-et-menthe-edulcorants 1*
dl-alfa-tocopheryl-acetate 1*
pottasium-sorbate 1*
caramel-layer 1*
fr:g-cellu-ose 1*
palm-kernel-and-palm-oil-whey-protein-isolate 1*
fr:extrato-de-malte-de-cevada 1*
vanilla-cream-flavored-layer 1*
es:cebada-riboflavina 1*
fr:verdikkingsmiddel 1*
mal 1*
it:mi 1*
Chia 1
fr:chocolate-de-leite 1*
fr:stabilisante 1*
fr:protein-isolate 1*
flaxseed 1*
natural-flav 1*
es:mono-y-de-acidos-grasos 1*
fr:agenfd-enrobage 1*
raspberry-puree-concentrate 1*
raspberry-filling 1*
fr:acidulant 1*
fr:isolated-soy-protein 1*
consumption-may-cause-stomach-discomfort-and-laxative-effect 1*
it:maltitolo-in-polvere 1*
fr:soybean-011 1*
carnauba-leaf-wax 1*
glycerin-walnuts 1*
fr:sans-sucre-ajoute 1*
es:grasa-vegetal-jarabe-de-maiz-de-alta-fructosa-granillo-sabor-chocolate 1*
whole-grain-rolled-oat-flakes 1*
fr:arome-naturel-de-vanille-noisettes 1*
nonfat-m 1*
fr:store-in-a-cool 1*
contains-2-and-less-of-the-following 1*
sunflower-oil-with-tocopheryl 1*
fr:tarwebloem 1*
glazing-agent-carnauba-wax 1*
fr:oe-947 1*
fr:cellulose-gel 1*
fr:su33toffet-zutaten 1*
chromium-chelate 1*
fr:stabirtsant 1*
vitamin-e-acetate 1*
fr:peut-contenir-des-traces-d-autres-cereales-contenant-du-glutem-d-uf 1*
fr:puede-contener-ancias-de-leche 1*
E639 1
fr:matricaria-recutita 1*
pl:aromaty 1*
fr:e17-1 1*
fr:extrait-d-anis-vert 1*
Malt extract 1
fr:swcctencrs 1*
fr:emulgatoc-oe-322-se 1*
fr:proteine-de-soja2 1*
fr:t-903 1*
sucrlose 1*
it:rispetta-ingredienti 1*
fr:leche-entera-en-polvor-pasta-de-cacao 1*
it:leticina-di-soia 1*
fr:agent-de-charae 1*
sucr 1*
vanilla-bean-specks 1*
fr:cheshire 1*
fr:596 1*
fr:gum-ticorice-extract 1*
Baking powder 1
fr:grcdients 1*
fr:brilliantb-ue 1*
fr:liquorice-chewing-gum 1*
green-tea-ex 1*
fr:chloride 1*
sucrose-fatty-acids-esters 1*
bees-wax 1*
natural-and-artificial-flavors-glycerin 1*
acesulfame-potassi 1*
Lemon juice from concentrate 1
sv:skummjolkspulver 1*
fr:ornithoga-um-umbellatum-l 1*
fr:erdnussmehl 1*
Manganese sulfate 1
phytonadione 1*
fr:vanillinę 1*
fr:soja-en-andere-noten-bevatten 1*
fr:poudre-de-cacao-maigre-alcalinise 1*
fr:3-2mg-menthol 1*
fr:garniture-de-fraises-framboises 1*
maltiol 1*
fr:hydratant 1*
fr:insuline 1*
it:estratto-di-malto-di-mais-e-di-orzo 1*
fr:120 1*
fr:533 1*
fr:graines-de-sesame-grillees 1*
tapioca-dextrin 1*
Dough 1
contains-2-and-less-salt 1*
beet-juice 1*
v 1*
fr:aenthalt-gluten 1*
fr:hefianthemum-nummu 1*
contains-1-percent-and-less-of 1*
fr:chocolate-flavored-chips 1*
fr:de-mauve 1*
fr:glycerine-vegetale-et-sorbitol 1*
e 1*
de:sucraiose 1*
citrus-acid 1*
aspartame-sunflower-lecithin 1*
fr:semente-de-linhaca-mofda 1*
fudge-filling 1*
fr:aspatame 1*
and-coconut-with-sodium-metabisulfite 1*
de:fruchtfullung 1*
to-prevent-sticking 1*
es:aromat-antioxidantes 1*
fr:glycerine-vegetale 1*
de:zusammensetzung-pro-pastille 1*
fr:agent-dlenrobage 1*
peanut-butter-ripple 1*
fr:nest-pas-conseille-aux-enfants-moins-de-3-ans 1*
chocolate-mass 1*
sv:vassleproteinisolat 1*
fr:tet-oe-422 1*
fr:elq2 1*
sucarlose 1*
fr:kakaobutter 1*
fr:unsweetened-chocolate 1*
fr:pate-de-caramel 1*
Ground almonds 1
fr:une-consommation-excessive-peut-source-de-leffets-laxatifs 1*
Millet 1
fr:e 1*
E142 1
es:12-g 1*
citric-acid-lemon-juice-concentrate 1*
fr:cacau-magro-em-pe 1*
fr:e1-7-t 1*
fractionate-palm-kernel-oil 1*
lactase-enzymes 1*
es:copos-de-cereales-sin-azucares-afiadidos-con-edulcorantes 1*
es:gaiato-de-propilo 1*
es:esteres-de-propilenicol-de-acidos-grasos 1*
oligofru 1*
fr:menthe-edulcorants 1*
Noodle 1
fr:zout 1*
th:sugar-free-yogurt-coating 1*
fr:contient-une-source-de-phenylananine 1*
fr:aspartaam 1*
fractionated-palm-kernel-oil-and-partially-hydrogenated-palm-oil 1*
fr:roasted-peanutpieces 1*
finished-product-contains-the-equivalent-0-2-raspberries 1*
fr:sufjungsmittej 1*
fr:jus-a-base-de-concentre-de-fraise 1*
fr:ubetzugsrnittei 1*
chocolate-swirl 1*
fr:toasted-oats 1*
fr:maltodextrine-aromes 1*
fr:0-9-arome-tarachldel 1*
fr:voir-en-gras 1*
it:cioccolato-senza-zucchero-con-edulcorante 1*
fr:0-9 1*
natura 1*
fr:une-consommation-des-effets-laxatifs 1*
fr:acidulante 1*
it:agente-di-carica 1*
fr:tocopherols-ajoute-pour-proteger-la-saveur 1*
fr:box-3000 1*
sv:overdrag 1*
fr:tate-lyle 1*
E339ii 1
cherry-juice-concentrate 1*
fr:ride 1*
D-alpha tocopheryl acetate 1
es:carbonatos-de-sodio-y-de-amonio 1*
E401 1
fr:32-t 1*
fr:zuckerkulor 1*
natural-and-artifical-falvors 1*
fr:mentos-aly-rpreserver-la-blancheur-naturelle-chewing-gum-avec-edulcorants 1*
it:italy-melle-van 1*
es:contiene-derivado-de-leche 1*
fr:roasted-hazelnut-kerneis 1*
fr:ecids 1*
bleached-enriched-flour 1*
fr:hinweis 1*
modified-food-starch 1*
fr:ingredienten 1*
bha-to-maintain-freshness 1*
invert-evaporated-cane-sugar 1*
neotame-and 1*
fr:edul 1*
E172 1
fr:18 1*
soy-prote 1*
fr:a-source-of-pheny 1*
fr:t-gomme-base 1*
fr:lecithines-sucroesters-d-acides-gras 1*
de:feuchthalte 1*
fr:rapeseed-cil 1*
fr:redients 1*
fr:une-consommation-642-258-02-excessive-peut-avoir-des-effets-laxatifs 1*
fr:peanuts-and-sulphur-dioxide 1*
Beta-carotene dye 1
fr:maltodextrine-stabilisant 1*
fr:cwb-7ra 1*
fr:constituye-una-fuente-de-fenifalanina 1*
modified-milk 1*
sunflower-o 1*
sodium-seenite-phyllquinone 1*
premier-protein-fiber-protein-blend 1*
fr:excessive-consurnption-have-a-laxative-ef 1*
Durum wheat 1
fr:aspartame-acesuifame-k 1*
fr:c-903 1*
sodium-c 1*
de:sorbit-kaumasse 1*
fr:une-alimentation-varie 1*
less-than-1-5-of-heavy-cream 1*
fr:egg-white-powder 1*
fr:less-than-2-of-the-following 1*
fr:h-warmte-en-vocht-vrijwaren 1*
fr:une-consommation-excessive-peut-avoir-des-effels-laxatifs 1*
fr:not-suitable-for-vegetarians 1*
fr:5-feuchthaltemit 1*
gm-arabic 1*
low-fat-cocoa 1*
fr:kaugummi-mit-mintgeschmack 1*
xanthan-gu 1*
fr:voedingszuren 1*
fr:kz-ehgredienb 1*
es:copos-de-cereales-recubiertos-de-chocolate-con-leche 1*
sodium-acid-pyrophosphate 1*
th:manufactured-in-a-facility-thot-roreeeas-b00-whaat 1*
contains-2-and-less-of-cellulose-gum 1*
fr:e965-proteines-de-lactoserum-de 1*
fr:co-orante-brillante-fcf 1*
polished-with-vegetable-oils 1*
sodi 1*
soy-flour-whole-wheat-flour 1*
multigrains 1*
protein-isolate 1*
fr:carbonate-acide-de-sodium-agent-d-enrobage 1*
fr:huile-de-palme-fractionnee 1*
partially-defatte 1*
fr:fruit-juice-and-grain-dextrins 1*
fr:menthol-6-6-mg 1*
fr:v-agent-d-enrobage 1*
sodium-caseinate-sugar-free 1*
fr:leite-gordo-em-pe 1*
fr:achillee 1*
roasted-salted-almonds 1*
fi:pintakasittelyaine-mehilaisvaha 1*
chocolate-layer 1*
fr:el-41-une-consommation-excessive-peut-avoir-des-effets-laxatifs 1*
fr:germany-zutaten 1*
fr:amandelen 1*
gun-base 1*
E909 1
cream-pie-ingredients 1*
fr:poudre-de-cacao-faible-en-gras 1*
fr:du-sesame-et-des-nix-hydrolysee 1*
fr:et-extraie-de-plantes-co-crane 1*
roasted-almonds 1*
fr:c-322 1*
toffee-pieces 1*
as-d-alpha-tocopheryl-acetate 1*
it:edulcoloranti 1*
soy-lecithin-whole-eggs 1*
fr:contient-une-source-de-phenylalaline 1*
nutmeats 1*
th:cot-an-black-currant-juice 1*
individual-tolerance-will-vary 1*
fr:matieres-grasses-vegetales-de-tournesol 1*
Sweetened condensed milk 1
citrus-extract 1*
fr:candy-sugar-free-withsweeteners 1*
natur 1*
ph-adjuster 1*
potassium-sorbate-and-vitamin-e-mixed-tocopherols 1*
fr:eni 1*
polyglycitol 1*
de:polyphosphat 1*
es:midextrosa 1*
fr:ne-c-nsommation-excessive-valeurs-enerjetiques-ct 1*
fr:acontient-gluten 1*
fr:manteca-de-cacao 1*
fr:2400 1*
popylene-glycol-monoester 1*
fr:e98g-strasbourg-cedex-2 1*
fr:amidon-d-cea 1*
fr:fractionated-palm-kernel-oil 1*
fr:information-nutritionnelle-pour-100g 1*
fr:processed-with-alw 1*
sugar-free-chocolate-flavored-coating 1*
fr:short-chain-fructooligosaccharides 1*
fr:resine-de-propolis 1*
graham-flour 1*
partially-hydrogenated-soybean-and-cottonseed-oils 1*
arabinoglactan 1*
procedded-wiyh-alkali 1*
fr:frangitarte-zonder-toegevoegde-suiker 1*
Corn maltodextrin 1
fr:souffle 1*
es:zumo-concentrado-de-sauco 1*
chocolat 1*
fr:frambozen 1*
fr:ln 1*
es:acido-gitrico 1*
contain-less-than-2-of-each-of-the-following 1*
fr:sucralose-acesulfame-k 1*
fr:saiz 1*
fr:caramel-amoniacal 1*
fr:machez-apres-avoir-mange-et-bu 1*
it:carbonato-acido-d-ammonio 1*
evaporated-cane-juice 1*
it:fibra-alimentare 1*
D-Biotin 1
fr:zoetstof 1*
fr:isolat-de-proteine-de-soja-et-de-polyglycerol-polyrizinoleate 1*
Natural flavor of turmeric 1
and-artificial-color 1*
toasted-coconut 1*
as-palmitate 1*
Raisin 1
Corn oil 1
as-calcium-ascorbate 1*
fr:agent-antioxydant 1*
and-salt 1*
sunflow 1*
Rice extract 1
fr:Cacao en poudre fortement dégraissé 1
E302 1
Honey 1
fr:chocolat-non-sucre 1*
sv:kola 1*
es:estevia 1*
sa 1*
fr:chlorophyllines-e140 1*
natural-cinnamon-flavor 1*
Nutmeg 1
nonfat-yogurt-powder 1*
fr:extrait-riche-copherol 1*
fr:emuigatoren 1*
es:contiene-sorbitol-0-03-g 1*
fr:naturel-de-citron 1*
glucono-delta-lact 1*
fr:proteinas-de-la-leche 1*
blue-1-and-yellow-5-6 1*
fr:getrockneter-glukosesirup 1*
es:carbonao-calcio 1*
es:6-93g 1*
green-te 1*
milk-protein-lsolate 1*
fr:Arôme naturel de noisette 1
chloride 1*
fr:une-alimentation-variee-et-ainsi-ou-un-de-vie-sain-sont-import-nts 1*
cream-salt 1*
Royal jelly 1
de:sussungsmittel-isomalt 1*
fr:Éclats de caramel 1
fr:high-oleic-safflower-011 1*
fr:dont-16-dans-le-centre 1*
it:estratto-vegetale-ricco-in-tocoferolo 1*
it:pari-al-5-sul-totale 1*
nu 1*
hu:napraforgomag 1*
sv:arom 1*
fractioned-palm-kernel-oil 1*
fr:gummi-arabicumt-cellulosegummi 1*
fr:maltitolsirap 1*
fr:arome-amande-grillee 1*
Enzyme 1
es:salvado-polidextrosa 1*
de:sussungsmittel-aspartam 1*
fr:arome-naturel-d-eucalyptus 1
Malted wheat flour 1
strawberry-juice-concentrate 1*
fr:pate-de-sesame-edulcorant 1*
fr:frboxymethylcellulose 1*
fr:retioyl-acetate 1*
fr:soy-protein-isolate 1*
fr:iraedlents 1*
nl:salmiakzout 1*
de:farbstoff-echtes-karmin 1*
fr:natural-and-artificial-falvoring 1*
milk-solids 1*
fr:acesulfame-k-agent-de-charge 1*
fr:gum-stabiliser 1*
iii 1*
fr:farinha-de-amendoim 1*
High fructose corn syrup 1
fr:calcium-caseinate 1*
fr:mrne 1*
fr:cire-de-carnauba-bha 1*
fr:huile-essentielle-d-illicium-verum 1*
fr:aroma-tcacahuetel 1*
fr:essence-d-anis-etoile-1-3-mg 1*
cottonseed 1*
fr:flocos-de-aveia 1*
fr:97 1*
fr:aroma-proteinmtschung 1*
es:azucar-cocoa-grasa-vegetal-azucar-invertido 1*
contains 1*
fr:cloruro-sedico 1*
fr:contient-une-source-de-phenylalaninne 1*
tapioca-starch-modified 1*
chocolate-flavored-layer 1*
fr:index-glycemique-reduit-a-l-isomalt 1*
fr:arome-eau 1*
artificial-colors-yellow-5 1*
fr:aspartame-acesulfarne-k 1*
cellulose-gel 1*
fr:tree-nut-and-wheat-ingredients 1*
th:modified-vegetable-oil-pale-k-palm-o-strawberry-juice-concentrate-citrate 1*
fr:46-de-matieres-grasses-par-rapport-a-des-barres-au-chocolat-et-a-la-noisette-classiques 1*
fr:ayitol-3it5 1*
fr:emulgatore 1*
fr:une-consommation-es-efetsbat-ts-767-kj 1*
fr:echinacea-purpurea 1*
lactic-acid-esters-of-mono-and-diglycerides-with-citric-acid 1*
es:cocoy-girasol 1*
Hydrogenated oil 1
E260 1
defatted-soy-flour 1*
fr:glucono-delta-lacton 1*
fr:ed 1*
dry-roasted-peanuts 1*
bht-to-maintain-freshness 1*
rapeseed-oil 1*
fr:chocolate-con-leche 1*
soup-base 1*
partially-hydrogenated-vegetable-oils 1*
fr:poudre-de-fruits 1*
fr:chocolat-blanc-avec-edulcorant 1*
turmeric-grape-juice-extract-and-stevia 1*
fr:feuchttaltemittel 1*
fr:important-information 1*
fr:31-sorbitol 1*
fr:cla0 1*
fr:chewing-gum-avec-edulcorants 1*
isolate 1*
fr:prepare-avec-alkali 1*
fr:chocolate-flavored-coating 1*
soy-lecithin-sucralose 1*
fr:soy-protein-crisps 1*
fr:arome-naturel-diorange 1*
hu:extrudalt-gabonapelyhek 1*
fr:marshmallow-binder 1*
fr:6-7mg-jus-d-acerola-concentre-deshydrate 1*
fr:flocons-de-cereales-completes-et-grillees 1*
fr:huiles-essentielles-de-pin-sylvestris 1*
Hydrogenated palm oil 1
from-c 1*
sunflowers-oil-with-tocopherol 1*
and-citrus-extract 1*
Fully hydrogenated vegetable fat 1
fr:isoiated-soy-pro 1*
a-preservative 1*
fr:sel-d-aspartame-cesulfame 1*
fr:gerestete-extrakt 1*
es:saborizante-artificial-chocolate 1*
fr:suggested-use 1*
es:rojo-40-y-rojo-3 1*
fr:milk-protein-concentrate 1*
fr:au-moins-20-mangeet-bu 1*
fr:sorbi 1*
da:Fedtfattig kakao 1
orange-oil 1*
fr:erithrytol 1*
fr:tan-tristearate 1*
fr:a-contiene-gluten 1*
fr:cire-de-habaft-contientunesourcede-phenylalanine 1*
fr:pulmonaire-7-4-mg 1*
carnauba-w 1*
fr:cocoa-fructose-liquid 1*
fr:raisins-de-smyrne-22-1-sucre 1*
fr:um-phosphate 1*
fr:natu 1*
fr:pepins-de-grenade-deshydrate 1*
it:sede-e-stabilimento-via-xxv-aprile-7-20020-lainate 1*
fr:processed-with-alkali 1*
fr:trozos-de-cacahuetes-tostados 1*
mono 1*
fr:arabische-gom 1*
fr:cesses-peanuts 1*
fr:sel-d-aspartame-acesulfal 1*
fr:sirop-de-sorbitol-12-e4200 1*
fr:neohesperidin-dc 1*
contains-phenylalanine 1*
de:feuchthaltmittel 1*
fr:lio 1*
fr:lecithines-soa-aissisants 1*
isolated-soy-protein 1*
es:azucar-leche-reconstituida 1*
fr:extrudat-de-cacao 1*
enzyme-modified-soy-protein 1*
pastel-coating 1*
E452i 1
fr:essence-d-aiguille-de-sapin 1*
fr:fabrique-dans-un-etablissement-et-l-on-utilise-du-ble 1*
E927b 1
fr:crzea-prctein-barwith-hazelnuts 1*
fr:Yogourt maigre 1
cocoa-extract 1*
partially-hydrogenated-palm 1*
fat-reduced-cocoa 1*
es:saborizantes-artificiales-y-naturales 1*
fr:and-almonds 1*
fr:attention 1*
fr:framboises-deshydratees 1*
manila-clam 1*
Sunflower seed 1
fr:glycerol-aromes 1*
fr:r-acidifiant 1*
less-than-2-percent-of 1*
fr:une-consommation-excessive-peut-avoir-des-effets-layatifs 1*
bht-to-maintain-freshness-sucralose 1*
fr:maltitolstroo 1*
natural-peppermint-flavor 1*
gum-arabica 1*
ph-control-agent 1*
fr:sirop-de-riz-brun 1*
it:un-consumo-eccessivo-puo-avere-effetti-lassativi 1*
fr:tein 1*
fr:acest-gomme-base 1*
apple-pie-ingredients 1*
white-tea-extract 1*
fr:oc 1*
fr:soy-leci 1*
fr:kokos 1*
Kiwi 1
fr:extrait-de-stevia-rabaudiana 1*
fr:subungsmittej 1*
fr:allergens 1*
fr:esters-d-acide-tartrique-de-mono-et-diglycerides-acetyles 1*
cocoa-powd 1*
Bone 1
fr:uk 1*
fr:ment-degraissee 1*
crisp-rice 1*
Dark chocolate chunks 1
fr:concentre-de-proteines-de-lait 1*
es:cereal-extruido-de-trigo-y-arroz 1*
fr:contient-laitl-et-soja2 1*
es:integral 1*
fr:manufactured-in-a-facility-that-pro 1*
fr:petit-lait-en-poudre-enrichi-en-proteines 1*
fr:agent-dienrobage 1*
mono-diglyceri 1*
egg-albumen 1*
fr:xarope-de-maltitol 1*
fr:une-consommation-excessive-peu-avoir-deseffetslaxatifs 1*
fr:eftait-de-reglisse 1*
es:este-producto-contiene-trigo-y-otros-cereales-con-gluten 1*
fr:chocolate-layer 1*
fr:at 1*
fr:consume-as-a-high-protein-snack-throughout-the-day-or-in-between-meals-tsuch-like-between-breakfast-and-lunch-or-a-mid-afternoon-nutritious-feed-to-increase-your-daily-protein-intake 1*
fr:acontainsgluten-lngredlents 1*
fractionated-palmkernel-oil 1*
fr:sojaprotejn-fsolat 1*
Evaporated milk 1
fr:farine-d-arachlde 1*
fr:inc 1*
fr:fructose-liquid 1*
fr:agents-de-glacagg 1*
fr:naturales-colorantes 1*
fi:yrttiuute 1*
fr:excessive-consumption-may-produce-laxative-effects 1*
fr:conditions-de-conservation-itabri-de-la-chaleur-et-de-ithumidlte 1*
hydrogenated-starch-hydrolysate 1*
to-promote-color-retention 1*
fr:isola-de-proteine-de-soja 1*
fr:e830 1*
fr:comme-base 1*
fr:v-mannitol 1*
fr:c-951 1*
fr:erdnusse 1*
it:fosfato-di-calcico 1*
fr:32-poids-net 1*
hydrogenated-cottonseed 1*
fr:amandes-hachees-et-grillees 1*
manila-clam-broth 1*
color-added-red-40 1*
Coconut flakes 1
es:grasa-vegetal-de-palma-no-hidrogenada 1*
fr:acesuffame-k 1*
fr:de-carnauba 1*
fr:dioxyde-de-emulsifiant 1*
fr:petales-de-riz 1*
fr:noisettes-entieres-et-hachees 1*
fr:ral-fiavor 1*
fr:fabrique-en-turquie 1*
fr:barley-malt 1*
fr:kann 1*
fr:el-200 1*
fr:this-product-is-intended-to-be-used-alongside-an-active-lifestyle-and-a-balanced-diet 1*
fr:non-ouvert 1*
fr:dro-enees 1*
th:yogurt-powder 1*
fr:arome-noisette 1*
fr:poudre-de-lactoserum-enrichie-en-proteines 1*
fr:fraicheur-intense-haleine-fraiche-a-l-extrait-de-the-vert-intense-sensation-de-fraicheur-en-bouche-chewing-gum-avec-edulcorants 1*
E141ii 1
fr:arome-de-bourgeons-de-sapin 1*
fr:humectit 1*
fr:ybonate-acide-de-sodium 1*
fr:lecithine-de-tourne-01 1*
fr:contient-des-sucres-naturels-une-consommation-excessive-peut-avoir-des-effets-laxatifs 1*
fr:agentdlenrobage 1*
fr:maltitolstroop 1*
fr:ylitol 1*
fr:epaisjsant 1*
fr:stabilis-lit 1*
E492 1
Natural lemon flavouring 1
fr:contient-une-sourc-de-phenylalanine 1*
fr:may-also-contain-barley 1*
fr:gycerol 1*
with-sodium-metabisulfite-for-color-retention 1*
fr:vollkon-haferflockena 1*
fr:bleu-acesulfame-k 1*
fr:corantes-yrpdientes 1*
es:zumo-de-naranja-concentrado 1*
fr:soya-protein-crisp 1*
fr:gomme-edulcorants 1*
fr:de-titane 1*
fr:fb-ngredients 1*
fr:huisifiant 1*
fr:triphosphate-maltodextrine 1*
fr:certains-ingredients-de-ce-produit-ne-proviennent-pas-de-france 1*
fr:h-o-nethylcellulose 1*
fr:une-peut-avoirdes-effets-laxatifs-a-l-abri-de-la-chaleur-et-de-l-humidite 1*
fr:non-flaconsommer-de-preference-avant-le 1*
fr:acesulfame-k-gomme-base 1*
fr:voir-fond 1*
fr:isomatt 1*
fr:b-p 1*
fr:chocolate-liquor 1*
fr:flocons-de-ble 1*
fr:acesulfame-k-sucralose 1*
de:Gerstenflocken 1
it:cruschello-di-frumento 1*
fr:extrait-de-mal-d-orge 1*
de:extrudat 1*
E451i 1
de:weisse-schokolade-mit-sussungsmittel 1*
de:mittel 1*
fr:isomalto 1*
fr:biscuit-sans-sucres-asoutes-avec-edulcorants 1*
fr:antioxydar 1*
de:sonnen 1*
de:blumenlecithine 1*
front-porch-lemonade-ingredients 1*
de:gehackt 1*
fr:gonflant 1*
de:gerostet 1*
fr:l-agent-de-charge 1*
sv:aggviteprotein 1*
fr:ebakjes-met-abrikozenvulling 1*
fr:pasta-de-cacau 1*
fr:zonderto-pevoegde-suiker-uv-gredienten 1*
fr:palmolie 1*
fr:feuchthaltemittel 1*
fr:acide-bitri-e 1*
fr:eieren 1*
fr:scharrel 1*
fr:agent-de-aarqe 1*
fr:abrikozen 1*
fr:oedingsvezel 1*
fr:rijstzetmeel 1*
E516 1
fr:agent-edulcorant 1*
fr:stabilisatoren 1*
fr:rijsmiddelen 1*
fr:conserveermiddel 1*
fr:arome-naturel-the-a-la-menthe 1*
Ferrous sulfate 1
fr:une-consommation-excessive-peut-avo 1*
fr:kaliumsorbaat 1*
fr:kan-laxatief-werken 1*
fr:j-melk 1*
fr:fangitarte-sans-sucre-ajoute-gateaux-au-fourrage-d-abricots 1*
fr:6037960 1*
fr:ngedients 1*
fr:pont-au-sol 1*
fr:abricots-4-4-fibre-alimentaire 1*
fr:peut-avoir-un-effets-laxatifs 1*
fr:secerver-a-l-abri-de-la-chaleur-et-de-l-humidite 1*
fr:natriumalginaat 1*
fr:natriumbicarbonaat 1*
de:2-5g 1*
Firming agent 1
fr:calciumci 1*
E333 1
fr:aspartame-sucralose-acesulfame-k 1*
Elderflower 1
fr:including-cereals-containing-gluten 1*
fr:i 1*
fr:Préparation de matières grasses végétales 1
fr:extrait-de-plantain-4-4-mg 1*
fr:acesuldame-k 1*
Cane sugar 1
fr:preparation-laitiere-maigre 1*
fr:bonbons-aromatises-et-aux-edulcorants 1*
E518 1
fr:d-eucalyptus-globulus 1*
fr:contient-une-sotjrce-de-phenylalanine 1*
fr:fabrique-sur-des-equipements-ou-sont-egalement-utilises-du-gluten-et-des-noix 1*
es:0-008g 1*
de:sussungsmittel-xylit 1*
fr:huile-de-karite 1*
fr:excess-consumption-may-cause-a-laxative-effecti-storage 1*
fr:ingredients-obtenus-avec-du-mais-et-du-soja-genetiquement-modifies 1*
fr:gum-avec-edulcorants 1*
fr:cacao-maigre-en-poudre-2-4 1*
whey-protein-concent 1*
fr:5x42g-soja 1*
fr:maltedulcorants 1*
fr:conserver-dans-un-endroit-frais-et-sec 1*
fr:zuckerester-von-speisefettsauren 1*
fr:convient-aux-vecetadicho-ort 1*
fr:contient-une-source-de-phenylalanine-gneconsommatlon-excessive-peut-avoir-des-effets-laxatifs 1*
fr:arium 1*
fr:extrait-aromatique-de-the-vert 1*
sv:shea 1*
es:bicarbonato-de-sodio-500ii 1*
fr:bent-14-g-en-bron-van-fenylalanine 1*
es:jalea-sabor-pay-de-limon 1*
Sea salt 1
fr:emulsification 1*
Fennel 1
fr:huile-de-palmiste-entierement-durcie 1*
E417 1
Peppermint oil 1
fr:lacesulfame-de-potassium 1*
Natural star anise aroma 1
Natural aniseed aroma 1
fr:vegetales-palme-et 1*
fr:ten-minste-houdbaak-i0t 1*
Cereal crispies 1
fr:el-70 1*
fr:biscuit-au-cafe 1*
fr:en-dropsmaak 1*
fr:Lait écrémé reconstitué 1
es:de-c-v 1*
Coffee powder 1
fr:sweetenings 1*
es:sal-aromas-antioxidante 1*
E281 1
fr:thin 1*
fr:flavours-concentrated-fruit-luices-curcumin 1*
fr:vegetal-carbon 1*
fr:caseine-acide 1*
fr:ester-de-glucose 1*
fr:maltitolsiroop 1*
fr:may-contain-traces-of-milk 1*
es:la-venta-del-astillero 1*
fr:esulfamo-k 1*
fr:curcumina 1*
Bell pepper 1
fr:une-consomma 1*
fr:gomme-agent-denrobage 1*
fr:carbon-vegetal 1*
fr:thidener 1*
pretzels 1*
fr:acidiant 1*
fr:emu 1*
store-in-a-dry-and-cool-place 1*
fr:complejos-cupricos-de-oflla-zumo-de-sauco-concentrado 1*
fr:nsumo-excesivo-puede-tener-un-efecto-laxante 1*
fr:sorbitol-isomalt 1*
fr:extracto-de-te-verde 1*
E575 1
fr:conservar-en-lugar-fresco-y-seco 1*
finished-product-contains-the-equivalent-of-0-2-raspberries 1*
fr:to-be-stored-in-a-cool-and-dry-place 1*
fr:ingre 1*
fr:carame 1*
Plantain 1
es:guar-y-algarrobo 1*
fr:i-aromes 1*
fr:os-acidos-y-a-los-jugos-de-frutas-y-con-edu 1*
it:pari-al-2-5-sul-totale 1*
th:vegetable-glycerin 1*
es:tecitirta-da-scia 1*
fr:coeur-son-d-avoine 1*
fr:acesulfam 1*
fr:e14ii 1*
natural-artificial-flavors 1*
fr:colagenio-hidrolisado 1*
fr:cire-microcrystalline 1*
de:mit-apfel-und-erdbeer-subongsmittel 1*
fr:une-consommation-xcessive-peut-avoir-des-effets-laxatifs 1*
fr:copos-avena 1*
fr:acesuliame-k 1*
it:quindi-non-e-idoneo-al-consumo-da-parte-di-soggetti-allergici-a-tali-sostanze 1*
fr:gelatine-arachides 1*
fr:chocolat-avec-edulcorant 1*
fr:gomme-de-base-aromes 1*
fr:acesutfame 1*
fr:cire-de-carnauba-cire-microcrystalline 1*
fr:ciones-de-conservaci6n 1*
fr:ne-as-donner-aux-enfants-tes3-s 1*
fr:ingredientes 1*
fr:precaugion-d-em-lo 1*
sl:koncentrat-sirotkih-beljakovin 1*
Liquorice root 1
fr:boute-de-calcium 1*
fr:chocolat-noir-avec-edulcorant 1*
es:carbonato-de-calcio-e170i 1*
fr:i-isomalt 1*
th:allergen 1*
es:jalea-sabor-fresa-polidextrosa 1*
es:zumo-de-manzana-concentrado 1*
fr:sonnenblumen-lecithin 1*
fr:aromatise 1*
es:mezcla-de-edulcorantes 1*
fr:precautions-peut-avoir-aes-effe-ts-laxatifs 1*
fr:prunus-ceroeifera-ehrh 1*
fr:f 1*
fr:conservateu 1*
fr:analyse-moyenne-pour-100-gr 1*
fr:pbsahuje-cukor-a-siadidta 1*
fr:sans-conservateur 1*
fr:extrait-d-echinacee 1*
Reconstituted skimmed milk 1
sl:stabilizatorji 1*
Chicory fibre 1
fr:creme-fraiche-sel 1*
fr:may-induce-laxative-effects 1*
fr:k-sucralose 1*
Light cream 1
E472b 1
Potato 1
fr:milchprotein 1*
fr:lait-ten-ecreme-en-poudre 1*
fr:sucres-l-extrait-de-stevia-bonbons-sans-sucres-a-la-creme-fraiche-gout-caramel 1*
fr:acesu-fame-k 1*
fr:glycerine-klp 1*
fr:colo 1*
fr:comme-arabique 1*
fr:1009 1*
Sodium fluoride 1
fr:eant-e153 1*
fr:gemahlene-leinsamen 1*
fr:arome-de-ginseng-et-vitamines 1*
fr:rdes-effets-laxatifs 1*
fr:eleo-de-colza 1*
es:0-43-g 1*
es:cereal-extruido-de-arroz 1*
fr:i-acesulfame-thicking-agente 1*
modified-mil 1*
fr:see-ingredients-in-bold 1*
fr:colors-e153 1*
fr:bonbonsge-fies-aux-fruits-sans-sucres-avec-edulcorants 1*
fr:billes-croustillantes-au-ble-complet 1*
resistant-maltoxtrin 1*
fr:excessive-consumption-may-have-a-laxative-effecte-a-conserver-dans-un-endroit-frais 1*
fr:dry-shaded-place-fabricatt 1*
fr:peut-avoir-des-effets-laxatifs-en-cas-de-consommation-excessive 1*
and-neotame 1*
fr:essence-de-menthe 1*
fr:lecithine-de-soja2-et-monoglycerides 1*
fr:sirop-de-glu 1*
fr:ara 1*
fr:chides-et-oeufs 1*
fr:coeur-facon-nougat 1*
fr:proteine-de-soja2-texturee 1*
fr:emulsionante 1*
fr:maltodextrina 1*
fr:extrait-de-racine-de-chi 1*
fr:harina-de-cacahuete 1*
fr:coree 1*
fr:fabrique-sur-des-equipements-ou-sont-egalement-utilises-gluten 1*
fr:agent-de-charge-isomalt 1*
fr:dl-aipha-tocopheryl-acetate 1*
fr:bla-nutriciofijal 1*
fr:extrait-de-propolis 1*
E954 1
to-preser 1*
fr:poudre-maltitol 1*
natural-and-artificail-flavors 1*
peanut-butter-milk-protein-isolate 1*
fr:pectine-acidifiant 1*
sl:jajčni-beljak-v-prahu 1*
D-pantothenate calcium 1
fr:ewi-agents-de-glacage 1*
fr:vegetal 1*
es:grupo-industrial-vida 1*
es:sal-yodada-canela 1*
fr:colorante-e141 1*
fr:a-conserver-a-l-abri-de-la-chaleur-et-de-l-humidite 1*
fr:311 1*
fr:zoetmiddelen 1*
fr:0-13 1*
fr:ilestimportantd-avoirune-alimentation-vanee-et-equilibree-ainsi-qu-un-mode-de-vie-sain 1*
fr:matt-de-ble 1*
fr:arome-chlorophylle 1*
es:un-consumo-excesivo-puede-producir-efectos-laxantes 1*
fr:propolis 1*
fr:el-41 1*
fr:extrait-de-camomille 1*
fr:extrait-de-souci 1*
fr:maltftol 1*
Marigold 1
fr:e414f-acidifiants 1*
fr:arome-menthol 1*
fr:huile-essentielle-de-menthe-poivree 1*
fr:une-consommation-excessive-peut-avoirdes-effets-laxatifs 1*
fr:processed-with-alkalii 1*
fr:pimpinella-anisum 1*
th:cultured-whey-protein-concentrate 1*
chicory-extract 1*
fr:extrudes-de-soja-cisotat-de-proteines-de-soja 1*
es:identico-al-natural-nuez-y-natural-melaza 1*
fr:billettes-de-soja-cacaotees-7-8-cisoiat-de-proteines-de-soja 1*
fr:concentre-de-proteines-de-soja-texture 1*
fr:g-ycefine-cu 1*
fr:ave-a-maitada-torrada 1*
fr:potjdre-de-cacao-maigre-alcalinise 1*
fr:lactobacillus-casei-shirota 1*
fr:eromes 1*
th:surhitdl-almond-butter 1*
fr:chocolat-tait-maltitol 1*
fr:pofydextrose 1*
es:caramelo-clase-l 1*
fr:farine-de 1*
fr:maltitoll-milk-chocolates-flavoured-coating 1*
E323 1
fr:agent 1*
fr:digiycerides 1*
fr:ci-bique 1*
fr:anfi-oxydant 1*
fr:contient-de-ia-iecithine-de-soja 1*
fr:sorbate-de-potassium-edulcorants 1*
Paprika 1
fr:tion-excessive-peut-avoir-des-effets-laxatifs 1*
fr:edulccrants 1*
de:feuchthaltemittel-glycerin 1*
fr:humecttnts 1*
fr:ingredients-melange-proteique 1*
fr:une-consommation-excessive-eut-avoir-des-effets-laxatifs 1*
fr:hialtitol 1*
fr:el-61-b 1*
sodium-carboxymethylce 1*
fr:el-3 1*
E150d 1
fr:gomme-base-agent-de-charge 1*
asparatame 1*
fr:lecithine-de-tournesol-colorants 1*
fr:aromes-naturels-orange-mandarine 1*
fr:ontient-une-source-de-phenylalanine 1*
fr:e20-g-sucres-avec-menthe-verte 1*
fr:menthol-cristallise 1*
fr:xylital 1*
fr:concentre-des-radis 1*
fr:contient-une-sour-information-nutritionnelle 1*
fr:1-oog 1*
es:desnatada-en-polvo 1*
fr:aardbeien 1*
it:sale-marino-integrale 1*
monoand-diglycerides 1*
fr:aromes-humectant 1*
fr:fvbeutqe-lait 1*
th:and-soy 1*
fr:arome-naturel-de-nolsette 1*
fr:une-consommation-excessive-peut-avolr-des-effets-laxatif 1*
fr:pepins-de-genade-deshydrate 1*
fr:billettes-de-soja 1*
fr:cire-de-camauba 1*
Natural cocoa flavouring 1
fr:fabrique-dans-un-atelier-qui-utilise-lait 1*
fr:chocolat-noir-au-maltitol 1*
Chia seed 1
fr:extracto-de-malta-de-cebada-o 1*
fr:jarabe-de-glucosa-deshidratado 1*
fr:fabrique-dans-un-atelier-qui-utilise-fruits-a-coque 1*
fr:l-aspartame 1*
fr:agent-de-charge-phosphate-de-calcium 1*
fr:graisse-totalement-hydrogenee-de-noix-de-coco 1*
fr:rm-tltol 1*
citric-a 1*
fr:l-acesulfame-k 1*
fr:millo-clernatxs-vrtalbo-l 1*
fr:la-gomme 1*
fr:gomme-de-epaississeurs-arabique 1*
fr:ngredients 1*
fr:agent-colorant 1*
fr:321 1*
fr:sorbitou 1*
es:0-65-g 1*
fr:er-cesulfame-k 1*
fr:orrecteur-d-acidite 1*
fr:carbonate-acide-desodium 1*
es:s-a 1*
fr:agent-cire-de-carnauba 1*
fr:il-est-important-voir-une-alimentation-et 1*
fr:bha-contient-une-source-de-phenylalanine 1*
fr:excessive-peut-avoir-des-effets-laxatifs 1*
fr:chewing-gum-sans-sucres-avec-edulcorants 1*
fr:creeme 1*
Caramelised sugar syrup 1
es:contiene-sorbitol-0-03g 1*
de:uberzugsmittel-calciumcarbonat 1*
it:grano-farro 1*
key-lime-ingredients 1*
fr:ester-d-acides-gras-d-acide-ascorbique-aromes-colorant 1*
Carnauba wax coating agents 1
fr:vollmllchpulver 1*
peaches 1*
fr:amendoimi 1*
fr:sotningsmedel 1*
fr:e-cotouring 1*
fr:edulcopants-sorbffol 1*
Blackcurrant juice 1
fr:enrobage-fantaisie-au-cacao 1*
fr:masse-a-glacer-grasse-au-cacao 1*
Caramel syrup 1
fr:aqent-de-darge 1*
fr:antioridant 1*
fr:Pâte d'amande 1
es:lectina-de-soya 1*
E504 1
de:fullstoff-calciumphosphate 1*
fr:valeur-nutritionnelle-moyenne-pour-1-00-g-par-dragee 1*
fi:variaine-kurkuma 1*
fr:une-consommation-excessive-peut-des-effets-laxatifs 1*
es:valor-energetico-757-kj 1*
lactase-enzyme 1*
an 1*
fr:vollmilchpulver 1*
fr:essences-d-eucalyptus 1*
fr:kokos-en-amandelen 1*
fr:subungsmittel 1*
fr:palmfett 1*
fr:convient-aux-vegetariens 1*
fr:antionygene-e321 1*
fr:farbstoff 1*
th:sugar-free-fruit-layer 1*
fr:aromas-emuigator 1*
fr:sucratose 1*
fr:caramel-cotouring 1*
fr:sirop-de-polydextrose 1*
fr:vo-fmilchschokofade 1*
fr:subungsmittet-kakaobutter 1*
fr:molkenprotein-konzentrat 1*
fr:whole-milk-chocolate 1*
fr:peptides-de-collagene 1*
de:stevolglycoside 1*
fr:insect-larva 1*
fr:lecithine-de-tournesol-e472a 1*
fr:bevochtigingsmiddel 1*
fr:milk-chocolate-flavoured-caating 1*
hu:fagyasztva-szaritott-malnadarabka-es-malnapor 1*
fr:mannitol-witol 1*
fr:hydrolysed-whey-protein-isolate 1*
fr:vollmllchschokolade 1*
dried-skimmed-yoghurt 1*
fr:rescue-chewing-gum-aux-fleurs-de-bach-original-chewing-gum-sans-sucres-avec-edulcorants 1*
fr:arome-naturel-de-menthe-verte 1*
fr:dioxyde-de-tiane 1*
de:karmin 1*
fr:pedacos-de-amendoim-torrado 1*
th:monosodium-glutamate-sodium-ribonucleotides 1*
fr:fire-de-carnauba 1*
fr:fleurs-de-bach-original 1*
fr:impatjens-glandufrfera-royle 1*
fr:cuprix-complexes-of-chlorophyll-concentrated-e-derberry-juice 1*
fr:aux-fleurs-de-bach-menthe-verte 1*
butteroil 1*
fr:il-glycerine-emulsifiant 1*
dried-whey 1*
fr:acesulfame-kj-neohesperidine-dc 1*
fr:acesulfaam-k 1*
fr:yerdikkin 1*
fr:en-braambessensap-uit-concentraat 1*
fr:e903t-antioxydant 1*
fr:zuurmiddel 1*
fr:zuur 1*
fr:xarope-de-glucose-desidratado 1*
fr:teregelaar 1*
fr:natriumcitraat-overmatig-gebruik-kan-laxerend-werken-geschikt-voor-vegetariers 1*
fr:whey-protein-concentrate-milk-humectants 1*
it:farine 1*
strawberry-concentrate 1*
fr:ea76 1*
fr:extrait-de-the-bhnc 1*
E140 1
fr:fructo-uligosaccharides 1*
fr:calci 1*
fr:for-allergens 1*
fr:excessive-consumption-may-cause-a-laxative-effect 1*
fr:dry-place-away-from-direct-sunlight 1*
es:elaborado-en-equipo-que-procesa-productos-con-nueces-de-arboles 1*
fr:extrait-de-reglisse-5-7-mg 1*
fr:thehutgroup-meridian-house 1*
vitamin-and-mineral-blend 1*
fr:palm-and-palm-kernel-cil 1*
fr:cire-camauba 1*
fr:el176 1*
fr:glyceroll-fructo 1*
fr:oligosaccharidesi-mineral-blend 1*
fr:milk-mineral-complex 1*
it:farinee-fiocchi-di-cereali 1*
fr:arome-naturel-de-menthe-et-d-eucalyptus 1*
fr:phosphorous 1*
fr:extrait-de-fenouil 1*
Magnesium 1
ma 1*
Potassium 1
es:saborizante-natural-y-artificial-a-fresa 1*
fr:gomade-celulosa 1*
Ferric diphosphate 1
fr:vitamin-blend 1*
fr:calcium-d-pantothenate 1*
fr:t-raisins-de-corinthe-4-496 1*
fr:arotte-noire 1*
es:proteina-de-soya-saborizante-natural-y-artificial-a-vainilla 1*
fr:extrait-de-cartlame 1*
ascorbate 1*
Dehydrated glucose syrup 1
sodium-copper-chlorophyll-color 1*
sal-and-mango-in-varying-proportions 1*
fr:ground-flaxseed 1*
fr:flavouring-tpeanutj 1*
fr:tocopherol-richextraet 1*
fr:graines-de-lin-moulues 1*
fi:happamuudensaatoaine-sitruunahallo 1*
and-vanilla 1*
eater 1*
fr:flocos-de-aveia-integrala 1*
fr:grasa-de-palma 1*
fr:rapsol 1*
fr:fettreduziertes-kakaopulver 1*
fr:i-viol-011-alm-oil 1*
fr:humectante 1*
fr:colegeno-hidrolizado 1*
fr:aceite-de-nabina 1*
fr:arome-de-ginseng 1*
fr:semillas-de-lino-molidas 1*
fr:cacao-magro-en-polvo 1*
es:crispin-de-maiz-y-arroz 1*
maltitol-sorbitol 1*
fr:wasser 1*
fr:extracto-rico-en-tocoferoles 1*
fr:protefnas-de-leite 1*
fr:humidificante 1*
fr:glicerol 1*
fr:1-0-cacao-maigre-en-poudre 1*
fr:c 1*
fr:morceaux-d-arachldes-grilles 1*
fr:18-gerosteter-hafermalz 1*
fr:concentre-de-jus-de 1*
fr:haferflocken 1*
No6 1*
hu:rizsliszt 1*
natural-and-artifical-flavors 1*
fr:zucker 1*
cookie-dough-ingredients 1*
caramel-swirl 1*
fr:azucar 1*
de:emulgator-sonnenblumenlecithine 1*
fr:mannitolevt-naltitol 1*
fr:emulgente 1*
fr:palmol 1*
fr:eleo-de-palma 1*
es:0-007g 1*
fr:i-contient-une-source-de-phenylalanine-traces-de-sola 1*
fr:acucar 1*
fr:manteiga-de-cacau 1*
cit 1*
fr:cloreto-de-sedio 1*
fr:extrato-rico-em-tocofereis 1*
fr:gerstenmalzextrakt-a 1*
fr:oatsj-eggs 1*
fr:aimes 1*
es:lactogliceridos 1*
fr:agent-lenrobage 1*
fr:fiavouring 1*
fr:une-consommation-excessive-peut-avoir-des-de-la-et-de-met-munt 1*
fr:frematig-gebrutl-kan-een-laxerend-effect-hebben 1*
fr:sifiant 1*
fr:base-de-gomme 1*
fr:warmtebewaren 1*
th:potassium-2-ingredients 1*
fr:excessive-consumption-laxative-effects 1*
fr:0-196 1*
fr:onsumentensewice-nl 1*
fr:0-10-etwmin 1*
th:uncooked-cornstarch 1*
sunflower-oil-with-tocopherol 1*
fr:eu-mondeiezintemational-com-sans-menthe-ingrellents 1*
fr:acide-acidifiant 1*
fr:esutfame-k 1*
fr:linten 1*
fr:zoetstofen 1*
fr:Jus concentré de cassis 1
fr:utact 1*
fr:zonnebloemledthine 1*
fr:g-ansmiddel 1*
Prune 1
fr:jus-de-citron-vert-en-poudre 1*
fr:goma-baf-estabilizador 1*
premier-protein-crisp-bar-protein-blend 1*
E1404 1
fr:cire-de-arnauba 1*
fr:morceaux-de-biscuits-gout-chocolat 1*
soy-cr 1*
es:ploidextrosa 1*
fr:179 1*
fr:emilsifiant 1*
fr:cose 1*
sucralose-acesulfame-potassium 1*
fr:mannit 1*
Rapeseed lecithin 1
ground-flax-seeds 1*
sv:aromer 1*
sv:ytbehandlingsmedel 1*
sv:oligofruktos 1*
sv:mjolkprotein 1*
fr:dutched-and-natural-cocoas 1*
fr:aspartane 1*
es:a-harina-de-trigo 1*
es:sorbato-potasico-acido-citrico 1*
es:saborizante-artificial-y-natural 1*
fr:de-cerise-noire-de 1*
es:mono-y-diglicerioos-monoestearato-de-sorbitan 1*
th:and-seeds 1*
E435 1
es:cmc-sodica 1*
es:10og 1*
Tree nuts 1
Sweetened condensed semi-skimmed milk 1
fr:entre-autres 1*